Lineage for d1lpab1 (1lpa B:337-449)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 11920Fold b.12: Lipase/lipooxygenase domain [49722] (1 superfamily)
  4. 11921Superfamily b.12.1: Lipase/lipooxygenase domain [49723] (3 families) (S)
  5. 11933Family b.12.1.2: Colipase-binding domain [49730] (1 protein)
  6. 11934Protein Pancreatic lipase, C-terminal domain [49731] (6 species)
  7. 11942Species Human (Homo sapiens) [TaxId:9606] [49734] (2 PDB entries)
  8. 11944Domain d1lpab1: 1lpa B:337-449 [23644]
    Other proteins in same PDB: d1lpaa1, d1lpaa2, d1lpab2

Details for d1lpab1

PDB Entry: 1lpa (more details), 3.04 Å

PDB Description: interfacial activation of the lipase-procolipase complex by mixed micelles revealed by x-ray crystallography

SCOP Domain Sequences for d1lpab1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lpab1 b.12.1.2 (B:337-449) Pancreatic lipase, C-terminal domain {Human (Homo sapiens)}
rwrykvsvtlsgkkvtghilvslfgnkgnskqyeifkgtlkpdsthsnefdsdvdvgdlq
mvkfiwynnvinptlprvgaskiivetnvgkqfnfcspetvreevlltltpc

SCOP Domain Coordinates for d1lpab1:

Click to download the PDB-style file with coordinates for d1lpab1.
(The format of our PDB-style files is described here.)

Timeline for d1lpab1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1lpab2