![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.12: Lipase/lipooxygenase domain (PLAT/LH2 domain) [49722] (1 superfamily) sandwich; 8 strands in 2 sheets; complex topology duplication: has weak internal pseudo twofold symmetry |
![]() | Superfamily b.12.1: Lipase/lipooxygenase domain (PLAT/LH2 domain) [49723] (4 families) ![]() |
![]() | Family b.12.1.2: Colipase-binding domain [49730] (1 protein) automatically mapped to Pfam PF01477 |
![]() | Protein Pancreatic lipase, C-terminal domain [49731] (6 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [49734] (3 PDB entries) |
![]() | Domain d1lpab1: 1lpa B:337-449 [23644] Other proteins in same PDB: d1lpaa1, d1lpaa2, d1lpab2 complexed with bng, ca, plc |
PDB Entry: 1lpa (more details), 3.04 Å
SCOPe Domain Sequences for d1lpab1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lpab1 b.12.1.2 (B:337-449) Pancreatic lipase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} rwrykvsvtlsgkkvtghilvslfgnkgnskqyeifkgtlkpdsthsnefdsdvdvgdlq mvkfiwynnvinptlprvgaskiivetnvgkqfnfcspetvreevlltltpc
Timeline for d1lpab1: