Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) many members have left-handed crossover connection between strand 8 and additional strand 9 |
Family c.69.1.17: Fungal lipases [53558] (5 proteins) |
Protein automated matches [190510] (4 species) not a true protein |
Species Candida antarctica [TaxId:34362] [236429] (5 PDB entries) |
Domain d4k6gb_: 4k6g B: [236433] automated match to d1tcaa_ complexed with edo |
PDB Entry: 4k6g (more details), 1.5 Å
SCOPe Domain Sequences for d4k6gb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4k6gb_ c.69.1.17 (B:) automated matches {Candida antarctica [TaxId: 34362]} alpsgsdpafsqpksvldagltcqgaspssvskpillvpgtgttgpqsfdsnwiplstql gytpcwispppfmlndtqvnteymvnaitalyagsgnnklpvltwsqgglvaqwgltffp sirskvdrlmafapdykgtvlagpldalavsapsvwqqttgsalttalrnaggltqivpt tnlysatdeivqpqvsnspldssylfngknvqaqavcgplfvidhagsltsqfsyvvgrs alrsttgqarsadygitdcnplpandltpeqkvaaaallapaaaaivagpkqncepdlmp yarpfavgkrtcsgivtple
Timeline for d4k6gb_: