Lineage for d4k6gb_ (4k6g B:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1615834Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 1615835Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 1616747Family c.69.1.17: Fungal lipases [53558] (5 proteins)
  6. 1616856Protein automated matches [190510] (4 species)
    not a true protein
  7. 1616861Species Candida antarctica [TaxId:34362] [236429] (5 PDB entries)
  8. 1616863Domain d4k6gb_: 4k6g B: [236433]
    automated match to d1tcaa_
    complexed with edo

Details for d4k6gb_

PDB Entry: 4k6g (more details), 1.5 Å

PDB Description: crystal structure of calb from candida antarctica
PDB Compounds: (B:) lipase b

SCOPe Domain Sequences for d4k6gb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4k6gb_ c.69.1.17 (B:) automated matches {Candida antarctica [TaxId: 34362]}
alpsgsdpafsqpksvldagltcqgaspssvskpillvpgtgttgpqsfdsnwiplstql
gytpcwispppfmlndtqvnteymvnaitalyagsgnnklpvltwsqgglvaqwgltffp
sirskvdrlmafapdykgtvlagpldalavsapsvwqqttgsalttalrnaggltqivpt
tnlysatdeivqpqvsnspldssylfngknvqaqavcgplfvidhagsltsqfsyvvgrs
alrsttgqarsadygitdcnplpandltpeqkvaaaallapaaaaivagpkqncepdlmp
yarpfavgkrtcsgivtple

SCOPe Domain Coordinates for d4k6gb_:

Click to download the PDB-style file with coordinates for d4k6gb_.
(The format of our PDB-style files is described here.)

Timeline for d4k6gb_: