Lineage for d4k6ka_ (4k6k A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2134062Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2134063Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2135098Family c.69.1.17: Fungal lipases [53558] (5 protein domains)
  6. 2135217Protein automated matches [190510] (5 species)
    not a true protein
  7. 2135222Species Candida antarctica [TaxId:34362] [236429] (5 PDB entries)
  8. 2135228Domain d4k6ka_: 4k6k A: [236432]
    Other proteins in same PDB: d4k6kb2
    automated match to d1tcaa_
    complexed with edo; mutant

Details for d4k6ka_

PDB Entry: 4k6k (more details), 1.6 Å

PDB Description: crystal structure of calb mutant d223g from candida antarctica
PDB Compounds: (A:) lipase b

SCOPe Domain Sequences for d4k6ka_:

Sequence, based on SEQRES records: (download)

>d4k6ka_ c.69.1.17 (A:) automated matches {Candida antarctica [TaxId: 34362]}
lpsgsdpafsqpksvldagltcqgaspssvskpillvpgtgttgpqsfdsnwiplstqlg
ytpcwispppfmlndtqvnteymvnaitalyagsgnnklpvltwsqgglvaqwgltffps
irskvdrlmafapdykgtvlagpldalavsapsvwqqttgsalttalrnaggltqivptt
nlysatdeivqpqvsnspldssylfngknvqaqavcgplfvighagsltsqfsyvvgrsa
lrsttgqarsadygitdcnplpandltpeqkvaaaallapaaaaivagpkqncepdlmpy
arpfavgkrtcsgivtp

Sequence, based on observed residues (ATOM records): (download)

>d4k6ka_ c.69.1.17 (A:) automated matches {Candida antarctica [TaxId: 34362]}
lpsgsdpafsqpksvldagltcqgaspssvskpillvpgtgttgpqsfdsnwiplstqlg
ytpcwispppfmlndtqvnteymvnaitalyagsgnnklpvltwsqgglvaqwgltffps
irskvdrlmafapdykgtvllavsapsvwqqttgsalttalrnaggltqivpttnlysat
deivqpqvsnspldssylfngknvqaqavcgplfvighagsltsqfsyvvgrsalrsttg
qarsadygitdcnplpandltpeqkvaaaallapaaaaivagpkqncepdlmpyarpfav
gkrtcsgivtp

SCOPe Domain Coordinates for d4k6ka_:

Click to download the PDB-style file with coordinates for d4k6ka_.
(The format of our PDB-style files is described here.)

Timeline for d4k6ka_: