Lineage for d4k5qa_ (4k5q A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2507025Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2507026Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2508322Family c.69.1.17: Fungal lipases [53558] (5 proteins)
  6. 2508473Protein automated matches [190510] (9 species)
    not a true protein
  7. 2508481Species Candida antarctica [TaxId:34362] [236429] (5 PDB entries)
  8. 2508482Domain d4k5qa_: 4k5q A: [236431]
    automated match to d1tcaa_
    mutant

Details for d4k5qa_

PDB Entry: 4k5q (more details), 1.49 Å

PDB Description: crystal structure of calb mutant dglm from candida antarctica
PDB Compounds: (A:) lipase b

SCOPe Domain Sequences for d4k5qa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4k5qa_ c.69.1.17 (A:) automated matches {Candida antarctica [TaxId: 34362]}
lpsgsdpafsqpksvldagltcqgaspssvskpillvpgtgttgpqsfdsnwiplstqlg
ytpcwispppfmlndtqvnteymvnaitalyagsgnnklpvltwsqgglvaqwgltffps
irskvdrlmafapdykgtvlagpldalavsapsvwqqttgsalttalrnaggltqivptt
nlysatdeivqpqvsnspldssylfngknvqaqavcgplfvighagsltsqfsyvvgrsa
lrsttgqarsadygitdcnplpandltpeqkvaaaalmapaaaaivagpkqncepdlmpy
arpfavgkrtcsgivtp

SCOPe Domain Coordinates for d4k5qa_:

Click to download the PDB-style file with coordinates for d4k5qa_.
(The format of our PDB-style files is described here.)

Timeline for d4k5qa_: