Lineage for d1lpbb1 (1lpb B:337-449)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 107800Fold b.12: Lipase/lipooxygenase domain (PLAT/LH2 domain) [49722] (1 superfamily)
  4. 107801Superfamily b.12.1: Lipase/lipooxygenase domain (PLAT/LH2 domain) [49723] (3 families) (S)
  5. 107820Family b.12.1.2: Colipase-binding domain [49730] (1 protein)
  6. 107821Protein Pancreatic lipase, C-terminal domain [49731] (6 species)
  7. 107829Species Human (Homo sapiens) [TaxId:9606] [49734] (2 PDB entries)
  8. 107830Domain d1lpbb1: 1lpb B:337-449 [23643]
    Other proteins in same PDB: d1lpba1, d1lpba2, d1lpbb2

Details for d1lpbb1

PDB Entry: 1lpb (more details), 2.46 Å

PDB Description: the 2.46 angstroms resolution structure of the pancreatic lipase colipase complex inhibited by a c11 alkyl phosphonate

SCOP Domain Sequences for d1lpbb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lpbb1 b.12.1.2 (B:337-449) Pancreatic lipase, C-terminal domain {Human (Homo sapiens)}
rwrykvsvtlsgkkvtghilvslfgnkgnskqyeifkgtlkpdsthsnefdsdvdvgdlq
mvkfiwynnvinptlprvgaskiivetnvgkqfnfcspetvreevlltltpc

SCOP Domain Coordinates for d1lpbb1:

Click to download the PDB-style file with coordinates for d1lpbb1.
(The format of our PDB-style files is described here.)

Timeline for d1lpbb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1lpbb2