SCOP 1.55: Domain d1lpbb1: 1lpb B:337-449

Lineage for d1lpbb1 (1lpb B:337-449)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.12: Lipase/lipooxygenase domain [49722] (1 superfamily)

4. Superfamily b.12.1: Lipase/lipooxygenase domain [49723] (3 families)

5. Family b.12.1.2: Colipase-binding domain [49730] (1 protein)

6. Protein Pancreatic lipase, C-terminal domain [49731] (6 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49734] (2 PDB entries)

8. Domain d1lpbb1: 1lpb B:337-449 [23643]
   Other proteins in same PDB: d1lpba1, d1lpba2, d1lpbb2

Details for d1lpbb1

PDB Entry: 1lpb, 2.46 Å

PDB Description: the 2.46 angstroms resolution structure of the pancreatic lipase colipase complex inhibited by a c11 alkyl phosphonate

SCOP Domain Sequences for d1lpbb1:

Sequence; same for both SEQRES and ATOM records:

>d1lpbb1 b.12.1.2 (B:337-449) Pancreatic lipase, C-terminal domain {Human (Homo sapiens)}
rwrykvsvtlsgkkvtghilvslfgnkgnskqyeifkgtlkpdsthsnefdsdvdvgdlq
mvkfiwynnvinptlprvgaskiivetnvgkqfnfcspetvreevlltltpc

Timeline for d1lpbb1:

• d1lpbb1 appears in SCOP 1.57
  
• d1lpbb1 appears in the current release, SCOPe 2.08