SCOPe 2.08: Domain d1lpbb1: 1lpb B:337-449

Lineage for d1lpbb1 (1lpb B:337-449)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.12: Lipase/lipooxygenase domain (PLAT/LH2 domain) [49722] (1 superfamily)
   sandwich; 8 strands in 2 sheets; complex topology
   duplication: has weak internal pseudo twofold symmetry

4. Superfamily b.12.1: Lipase/lipooxygenase domain (PLAT/LH2 domain) [49723] (4 families)

5. Family b.12.1.2: Colipase-binding domain [49730] (1 protein)
   automatically mapped to Pfam PF01477

6. Protein Pancreatic lipase, C-terminal domain [49731] (6 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49734] (3 PDB entries)

8. Domain d1lpbb1: 1lpb B:337-449 [23643]
   Other proteins in same PDB: d1lpba1, d1lpba2, d1lpbb2
   complexed with bog, ca, mup

Details for d1lpbb1

PDB Entry: 1lpb, 2.46 Å

PDB Description: the 2.46 angstroms resolution structure of the pancreatic lipase colipase complex inhibited by a c11 alkyl phosphonate

PDB Compounds: (B:) Lipase

SCOPe Domain Sequences for d1lpbb1:

Sequence; same for both SEQRES and ATOM records:

>d1lpbb1 b.12.1.2 (B:337-449) Pancreatic lipase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
rwrykvsvtlsgkkvtghilvslfgnkgnskqyeifkgtlkpdsthsnefdsdvdvgdlq
mvkfiwynnvinptlprvgaskiivetnvgkqfnfcspetvreevlltltpc

Timeline for d1lpbb1:

• d1lpbb1 first appeared (with stable ids) in SCOP 1.55
  
• d1lpbb1 appears in SCOPe 2.07