| Class b: All beta proteins [48724] (180 folds) |
| Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.2: SH3-domain [50044] (2 families) ![]() |
| Family b.34.2.1: SH3-domain [50045] (40 proteins) |
| Protein automated matches [190043] (8 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187799] (37 PDB entries) |
| Domain d4j9ba_: 4j9b A: [236428] automated match to d3eg2a_ complexed with peg; mutant |
PDB Entry: 4j9b (more details), 1.7 Å
SCOPe Domain Sequences for d4j9ba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4j9ba_ b.34.2.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pnlfvalydfvasgdntlsitkgeklrvlgynqtgewceaqtkngqgwvpsnyitpvn
Timeline for d4j9ba_: