SCOPe 2.08: Domain d4j9ic_: 4j9i C:

Lineage for d4j9ic_ (4j9i C:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.2: SH3-domain [50044] (2 families)

5. Family b.34.2.1: SH3-domain [50045] (40 proteins)

6. Protein automated matches [190043] (8 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187799] (37 PDB entries)

8. Domain d4j9ic_: 4j9i C: [236427]
   automated match to d3eg2a_
   complexed with gol

Details for d4j9ic_

PDB Entry: 4j9i, 2.2 Å

PDB Description: Crystal structure of the ABL-SH3 domain complexed with the designed high-affinity peptide ligand P17

PDB Compounds: (C:) Tyrosine-protein kinase ABL1

SCOPe Domain Sequences for d4j9ic_:

Sequence; same for both SEQRES and ATOM records:

>d4j9ic_ b.34.2.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lfvalydfvasgdntlsitkgeklrvlgynhngewceaqtkngqgwvpsnyitpvn

Timeline for d4j9ic_:

• d4j9ic_ first appeared in SCOPe 2.03
  
• d4j9ic_ appears in SCOPe 2.07