Lineage for d4j9ia_ (4j9i A:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1309919Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 1310020Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 1310021Family b.34.2.1: SH3-domain [50045] (40 proteins)
  6. 1310377Protein automated matches [190043] (5 species)
    not a true protein
  7. 1310393Species Human (Homo sapiens) [TaxId:9606] [187799] (15 PDB entries)
  8. 1310408Domain d4j9ia_: 4j9i A: [236426]
    automated match to d3eg2a_
    complexed with gol

Details for d4j9ia_

PDB Entry: 4j9i (more details), 2.2 Å

PDB Description: Crystal structure of the ABL-SH3 domain complexed with the designed high-affinity peptide ligand P17
PDB Compounds: (A:) Tyrosine-protein kinase ABL1

SCOPe Domain Sequences for d4j9ia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4j9ia_ b.34.2.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lfvalydfvasgdntlsitkgeklrvlgynhngewceaqtkngqgwvpsnyitpvn

SCOPe Domain Coordinates for d4j9ia_:

Click to download the PDB-style file with coordinates for d4j9ia_.
(The format of our PDB-style files is described here.)

Timeline for d4j9ia_: