SCOPe 2.05: Domain d1ethc1: 1eth C:337-448

Lineage for d1ethc1 (1eth C:337-448)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.12: Lipase/lipooxygenase domain (PLAT/LH2 domain) [49722] (1 superfamily)
   sandwich; 8 strands in 2 sheets; complex topology
   duplication: has weak internal pseudo twofold symmetry

4. Superfamily b.12.1: Lipase/lipooxygenase domain (PLAT/LH2 domain) [49723] (4 families)

5. Family b.12.1.2: Colipase-binding domain [49730] (1 protein)
   automatically mapped to Pfam PF01477

6. Protein Pancreatic lipase, C-terminal domain [49731] (6 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [49733] (1 PDB entry)

8. Domain d1ethc1: 1eth C:337-448 [23642]
   Other proteins in same PDB: d1etha2, d1ethb1, d1ethb2, d1ethc2, d1ethd1, d1ethd2
   complexed with bme, c8e, ca

Details for d1ethc1

PDB Entry: 1eth, 2.8 Å

PDB Description: triacylglycerol lipase/colipase complex

PDB Compounds: (C:) triacylglycerol acyl-hydrolase

SCOPe Domain Sequences for d1ethc1:

Sequence; same for both SEQRES and ATOM records:

>d1ethc1 b.12.1.2 (C:337-448) Pancreatic lipase, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}
arwrykvsvtlsgkkvtghilvslfgnegnsrqyeiykgtlqpdnthsdefdsdvevgdl
qkvkfiwynvinptlprvgaskitverndgkvydfcsqetvreevlltlnpc

Timeline for d1ethc1:

• d1ethc1 first appeared (with stable ids) in SCOP 1.55
  
• d1ethc1 appears in SCOPe 2.04
  
• d1ethc1 appears in SCOPe 2.06
  
• d1ethc1 appears in the current release, SCOPe 2.08