Lineage for d1ethc1 (1eth C:337-448)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 11920Fold b.12: Lipase/lipooxygenase domain [49722] (1 superfamily)
  4. 11921Superfamily b.12.1: Lipase/lipooxygenase domain [49723] (3 families) (S)
  5. 11933Family b.12.1.2: Colipase-binding domain [49730] (1 protein)
  6. 11934Protein Pancreatic lipase, C-terminal domain [49731] (6 species)
  7. 11945Species Pig (Sus scrofa) [TaxId:9823] [49733] (1 PDB entry)
  8. 11947Domain d1ethc1: 1eth C:337-448 [23642]
    Other proteins in same PDB: d1etha2, d1ethb1, d1ethb2, d1ethc2, d1ethd1, d1ethd2

Details for d1ethc1

PDB Entry: 1eth (more details), 2.8 Å

PDB Description: triacylglycerol lipase/colipase complex

SCOP Domain Sequences for d1ethc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ethc1 b.12.1.2 (C:337-448) Pancreatic lipase, C-terminal domain {Pig (Sus scrofa)}
arwrykvsvtlsgkkvtghilvslfgnegnsrqyeiykgtlqpdnthsdefdsdvevgdl
qkvkfiwynvinptlprvgaskitverndgkvydfcsqetvreevlltlnpc

SCOP Domain Coordinates for d1ethc1:

Click to download the PDB-style file with coordinates for d1ethc1.
(The format of our PDB-style files is described here.)

Timeline for d1ethc1: