Lineage for d1ethc1 (1eth C:337-448)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2773710Fold b.12: Lipase/lipooxygenase domain (PLAT/LH2 domain) [49722] (1 superfamily)
    sandwich; 8 strands in 2 sheets; complex topology
    duplication: has weak internal pseudo twofold symmetry
  4. 2773711Superfamily b.12.1: Lipase/lipooxygenase domain (PLAT/LH2 domain) [49723] (4 families) (S)
  5. 2773758Family b.12.1.2: Colipase-binding domain [49730] (1 protein)
    automatically mapped to Pfam PF01477
  6. 2773759Protein Pancreatic lipase, C-terminal domain [49731] (6 species)
  7. 2773773Species Pig (Sus scrofa) [TaxId:9823] [49733] (1 PDB entry)
  8. 2773775Domain d1ethc1: 1eth C:337-448 [23642]
    Other proteins in same PDB: d1etha2, d1ethb1, d1ethb2, d1ethc2, d1ethd1, d1ethd2
    complexed with bme, c8e, ca

Details for d1ethc1

PDB Entry: 1eth (more details), 2.8 Å

PDB Description: triacylglycerol lipase/colipase complex
PDB Compounds: (C:) triacylglycerol acyl-hydrolase

SCOPe Domain Sequences for d1ethc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ethc1 b.12.1.2 (C:337-448) Pancreatic lipase, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}
arwrykvsvtlsgkkvtghilvslfgnegnsrqyeiykgtlqpdnthsdefdsdvevgdl
qkvkfiwynvinptlprvgaskitverndgkvydfcsqetvreevlltlnpc

SCOPe Domain Coordinates for d1ethc1:

Click to download the PDB-style file with coordinates for d1ethc1.
(The format of our PDB-style files is described here.)

Timeline for d1ethc1: