SCOPe 2.03: Domain d4ixab_: 4ixa B:

Lineage for d4ixab_ (4ixa B:)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.6: C-terminal effector domain of the bipartite response regulators [46894] (4 families)
   binds to DNA and RNA polymerase; the N-terminal, receiver domain belongs to the CheY family

5. Family a.4.6.0: automated matches [191513] (1 protein)
   not a true family

6. Protein automated matches [190858] (9 species)
   not a true protein

7. Species Staphylococcus epidermidis [TaxId:176280] [236417] (1 PDB entry)

8. Domain d4ixab_: 4ixa B: [236418]
   automated match to d2z33a1

Details for d4ixab_

PDB Entry: 4ixa, 2.15 Å

PDB Description: Structure of DNA-binding domain of the response regulator SaeR from Staphylococcus epidermidis

PDB Compounds: (B:) Response regulator SaeR

SCOPe Domain Sequences for d4ixab_:

Sequence, based on SEQRES records:

>d4ixab_ a.4.6.0 (B:) automated matches {Staphylococcus epidermidis [TaxId: 176280]}
eqlefdglvlknlsktltinnieipmrikefellwylasregevisksellekvwgydyy
edantvnvhihrireklekhdflpytittvwglgykfers

Sequence, based on observed residues (ATOM records):

>d4ixab_ a.4.6.0 (B:) automated matches {Staphylococcus epidermidis [TaxId: 176280]}
eqlefdglvlknlsktltinnieipmrikefellwylasregevisksellekvwgantv
nvhihrireklekhdflpytittvwglgykfers

Timeline for d4ixab_:

• d4ixab_ is new in SCOPe 2.03-stable
  
• d4ixab_ appears in SCOPe 2.04
  
• d4ixab_ appears in the current release, SCOPe 2.08