Lineage for d4ixsa_ (4ixs A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130990Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2130991Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2132229Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2132230Protein automated matches [190151] (121 species)
    not a true protein
  7. 2133020Species Xanthomonas oryzae [TaxId:291331] [189393] (6 PDB entries)
  8. 2133037Domain d4ixsa_: 4ixs A: [236415]
    automated match to d1ukja_
    complexed with co3, gol

Details for d4ixsa_

PDB Entry: 4ixs (more details), 2.29 Å

PDB Description: native structure of xometc at ph 5.2
PDB Compounds: (A:) Cystathionine gamma-lyase-like protein

SCOPe Domain Sequences for d4ixsa_:

Sequence, based on SEQRES records: (download)

>d4ixsa_ c.67.1.0 (A:) automated matches {Xanthomonas oryzae [TaxId: 291331]}
alslatlaihggqspdpstgavmppiyatstyaqsspgehqgfeysrthnptrfayercv
aaleggtrafafasgmaatstvmelldagshvvamddlyggtfrlfervrrrtagldfsf
vdltdpaafkaairadtkmvwietptnpmlklvdiaaiaviarkhglltvvdntfaspml
qrplslgadlvvhsatkylnghsdmvggiavvgdnaelaeqmaflqnsiggvqgpfdsfl
alrglktlplrmrahcenalalaqwlethpaiekviypglashpqhvlakrqmsgfggiv
sivlkggfdaakrfcektelftlaeslggveslvnhpavmthasipvarreqlgisdalv
rlsvgiedlgdlrgdleralv

Sequence, based on observed residues (ATOM records): (download)

>d4ixsa_ c.67.1.0 (A:) automated matches {Xanthomonas oryzae [TaxId: 291331]}
alslatlaihggqspdpstgavmppiyatstyaqsrthnptrfayercvaaleggtrafa
fasgmaatstvmelldagshvvamddlyggtfrlfervrrrtagldfsfvdltdpaafka
airadtkmvwietptnpmlklvdiaaiaviarkhglltvvdntfaspmlqrplslgadlv
vhsatkylnghsdmvggiavvgdnaelaeqmaflqnsiggvqgpfdsflalrglktlplr
mrahcenalalaqwlethpaiekviypglashpqhvlakrqmsgfggivsivlkggfdaa
krfcektelftlaeslggveslvnhpavmteqlgisdalvrlsvgiedlgdlrgdleral
v

SCOPe Domain Coordinates for d4ixsa_:

Click to download the PDB-style file with coordinates for d4ixsa_.
(The format of our PDB-style files is described here.)

Timeline for d4ixsa_: