SCOPe 2.08: Domain d4irwa1: 4irw A:2-123

Lineage for d4irwa1 (4irw A:2-123)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.61: Streptavidin-like [50875] (8 superfamilies)
   barrel, closed; n=8, S=10; meander

4. Superfamily b.61.1: Avidin/streptavidin [50876] (2 families)

5. Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)

6. Protein Streptavidin [50878] (1 species)

7. Species Streptomyces avidinii [TaxId:1895] [50879] (128 PDB entries)

8. Domain d4irwa1: 4irw A:2-123 [236413]
   Other proteins in same PDB: d4irwa2
   automated match to d1hxza_
   complexed with btn, na, pdc, tb

Details for d4irwa1

PDB Entry: 4irw, 1.4 Å

PDB Description: Co-crystallization of streptavidin-biotin complex with a lanthanide-ligand complex gives rise to a novel crystal form

PDB Compounds: (A:) streptavidin

SCOPe Domain Sequences for d4irwa1:

Sequence; same for both SEQRES and ATOM records:

>d4irwa1 b.61.1.1 (A:2-123) Streptavidin {Streptomyces avidinii [TaxId: 1895]}
aaeagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgt
algwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtft
kv

Timeline for d4irwa1:

• d4irwa1 first appeared in SCOPe 2.03, called d4irwa_
  
• d4irwa1 appears in SCOPe 2.07