Lineage for d4itka1 (4itk A:1-94)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2933780Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) (S)
  5. 2934202Family d.15.4.0: automated matches [191632] (1 protein)
    not a true family
  6. 2934203Protein automated matches [191164] (24 species)
    not a true protein
  7. 2934257Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [236409] (2 PDB entries)
  8. 2934258Domain d4itka1: 4itk A:1-94 [236410]
    Other proteins in same PDB: d4itka2
    automated match to d3ab5a_
    complexed with fes, gol

Details for d4itka1

PDB Entry: 4itk (more details), 1.18 Å

PDB Description: the structure of c.reinhardtii ferredoxin 2
PDB Compounds: (A:) Apoferredoxin

SCOPe Domain Sequences for d4itka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4itka1 d.15.4.0 (A:1-94) automated matches {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
mfkvtfktpkgektidveadkylldaaeeagmdlpyscrsggcstccgklesgtvdqsdq
nmldedqlkqgfvltcvayptsdiviltdqeskl

SCOPe Domain Coordinates for d4itka1:

Click to download the PDB-style file with coordinates for d4itka1.
(The format of our PDB-style files is described here.)

Timeline for d4itka1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4itka2