SCOP 1.55: Domain d1hplb1: 1hpl B:337-449

Lineage for d1hplb1 (1hpl B:337-449)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.12: Lipase/lipooxygenase domain [49722] (1 superfamily)

4. Superfamily b.12.1: Lipase/lipooxygenase domain [49723] (3 families)

5. Family b.12.1.2: Colipase-binding domain [49730] (1 protein)

6. Protein Pancreatic lipase, C-terminal domain [49731] (6 species)

7. Species Horse (Equus caballus) [TaxId:9796] [49732] (1 PDB entry)

8. Domain d1hplb1: 1hpl B:337-449 [23640]
   Other proteins in same PDB: d1hpla2, d1hplb2

Details for d1hplb1

PDB Entry: 1hpl, 2.3 Å

PDB Description: horse pancreatic lipase. the crystal structure at 2.3 angstroms resolution

SCOP Domain Sequences for d1hplb1:

Sequence; same for both SEQRES and ATOM records:

>d1hplb1 b.12.1.2 (B:337-449) Pancreatic lipase, C-terminal domain {Horse (Equus caballus)}
rwryrvdvtlsgkkvtghvlvslfgnkgnsrqyeifqgtlkpdntysnefdsdvevgdle
kvkfiwynnvinltlpkvgaskitverndgsvfnfcseetvredvlltltac

Timeline for d1hplb1:

• d1hplb1 appears in SCOP 1.57
  
• d1hplb1 appears in the current release, SCOPe 2.08