Lineage for d1hpla1 (1hpl A:337-449)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2383397Fold b.12: Lipase/lipooxygenase domain (PLAT/LH2 domain) [49722] (1 superfamily)
    sandwich; 8 strands in 2 sheets; complex topology
    duplication: has weak internal pseudo twofold symmetry
  4. 2383398Superfamily b.12.1: Lipase/lipooxygenase domain (PLAT/LH2 domain) [49723] (4 families) (S)
  5. 2383445Family b.12.1.2: Colipase-binding domain [49730] (1 protein)
    automatically mapped to Pfam PF01477
  6. 2383446Protein Pancreatic lipase, C-terminal domain [49731] (6 species)
  7. 2383451Species Horse (Equus caballus) [TaxId:9796] [49732] (1 PDB entry)
  8. 2383452Domain d1hpla1: 1hpl A:337-449 [23639]
    Other proteins in same PDB: d1hpla2, d1hplb2
    complexed with ca

Details for d1hpla1

PDB Entry: 1hpl (more details), 2.3 Å

PDB Description: horse pancreatic lipase. the crystal structure at 2.3 angstroms resolution
PDB Compounds: (A:) Lipase

SCOPe Domain Sequences for d1hpla1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hpla1 b.12.1.2 (A:337-449) Pancreatic lipase, C-terminal domain {Horse (Equus caballus) [TaxId: 9796]}
rwryrvdvtlsgkkvtghvlvslfgnkgnsrqyeifqgtlkpdntysnefdsdvevgdle
kvkfiwynnvinltlpkvgaskitverndgsvfnfcseetvredvlltltac

SCOPe Domain Coordinates for d1hpla1:

Click to download the PDB-style file with coordinates for d1hpla1.
(The format of our PDB-style files is described here.)

Timeline for d1hpla1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1hpla2