SCOPe 2.08: Domain d1hpla1: 1hpl A:337-449

Lineage for d1hpla1 (1hpl A:337-449)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.12: Lipase/lipooxygenase domain (PLAT/LH2 domain) [49722] (1 superfamily)
   sandwich; 8 strands in 2 sheets; complex topology
   duplication: has weak internal pseudo twofold symmetry

4. Superfamily b.12.1: Lipase/lipooxygenase domain (PLAT/LH2 domain) [49723] (4 families)

5. Family b.12.1.2: Colipase-binding domain [49730] (1 protein)
   automatically mapped to Pfam PF01477

6. Protein Pancreatic lipase, C-terminal domain [49731] (6 species)

7. Species Horse (Equus caballus) [TaxId:9796] [49732] (1 PDB entry)

8. Domain d1hpla1: 1hpl A:337-449 [23639]
   Other proteins in same PDB: d1hpla2, d1hplb2
   complexed with ca

Details for d1hpla1

PDB Entry: 1hpl, 2.3 Å

PDB Description: horse pancreatic lipase. the crystal structure at 2.3 angstroms resolution

PDB Compounds: (A:) Lipase

SCOPe Domain Sequences for d1hpla1:

Sequence; same for both SEQRES and ATOM records:

>d1hpla1 b.12.1.2 (A:337-449) Pancreatic lipase, C-terminal domain {Horse (Equus caballus) [TaxId: 9796]}
rwryrvdvtlsgkkvtghvlvslfgnkgnsrqyeifqgtlkpdntysnefdsdvevgdle
kvkfiwynnvinltlpkvgaskitverndgsvfnfcseetvredvlltltac

Timeline for d1hpla1:

• d1hpla1 first appeared (with stable ids) in SCOP 1.55
  
• d1hpla1 appears in SCOPe 2.07