Lineage for d1loxa2 (1lox A:2-112)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2383397Fold b.12: Lipase/lipooxygenase domain (PLAT/LH2 domain) [49722] (1 superfamily)
    sandwich; 8 strands in 2 sheets; complex topology
    duplication: has weak internal pseudo twofold symmetry
  4. 2383398Superfamily b.12.1: Lipase/lipooxygenase domain (PLAT/LH2 domain) [49723] (4 families) (S)
  5. 2383399Family b.12.1.1: Lipoxigenase N-terminal domain [49724] (2 proteins)
  6. Protein 15-Lipoxygenase [49728] (1 species)
  7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [49729] (1 PDB entry)
  8. 2383402Domain d1loxa2: 1lox A:2-112 [23638]
    Other proteins in same PDB: d1loxa1
    complexed with fe2, rs7

Details for d1loxa2

PDB Entry: 1lox (more details), 2.4 Å

PDB Description: rabbit reticulocyte 15-lipoxygenase
PDB Compounds: (A:) 15-lipoxygenase

SCOPe Domain Sequences for d1loxa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1loxa2 b.12.1.1 (A:2-112) 15-Lipoxygenase {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
gvyrvcvstgasiyagsknkvelwlvgqhgevelgsclrptrnkeeefkvnvskylgsll
fvrlrkkhflkedawfcnwisvqalgaaedkywfpcyrwvvgdgvqslpvg

SCOPe Domain Coordinates for d1loxa2:

Click to download the PDB-style file with coordinates for d1loxa2.
(The format of our PDB-style files is described here.)

Timeline for d1loxa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1loxa1