Lineage for d1lnh_2 (1lnh 9-167)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 57022Fold b.12: Lipase/lipooxygenase domain (PLAT/LH2 domain) [49722] (1 superfamily)
  4. 57023Superfamily b.12.1: Lipase/lipooxygenase domain (PLAT/LH2 domain) [49723] (3 families) (S)
  5. 57024Family b.12.1.1: Lipoxigenase N-terminal domain [49724] (2 proteins)
  6. 57028Protein Plant lipoxigenase [49725] (2 species)
  7. 57037Species Soybean (Glycine max), isozyme L3 [TaxId:3847] [49727] (2 PDB entries)
  8. 57039Domain d1lnh_2: 1lnh 9-167 [23637]
    Other proteins in same PDB: d1lnh_1

Details for d1lnh_2

PDB Entry: 1lnh (more details), 2.6 Å

PDB Description: lipoxygenase-3(soybean) non-heme fe(ii) metalloprotein

SCOP Domain Sequences for d1lnh_2:

Sequence, based on SEQRES records: (download)

>d1lnh_2 b.12.1.1 (9-167) Plant lipoxigenase {Soybean (Glycine max), isozyme L3}
ghkikgtvvlmrknvldvnsvtsvggiigqgldlvgstldtltaflgrsvslqlisatka
dangkgklgkatflegiitslptlgagqsafkinfewddgsgipgafyiknfmqtefflv
sltledipnhgsihfvcnswiynaklfksdriffanqty

Sequence, based on observed residues (ATOM records): (download)

>d1lnh_2 b.12.1.1 (9-167) Plant lipoxigenase {Soybean (Glycine max), isozyme L3}
ghkikgtvvlmrknvldvnsvtsvtldtltaflgrsvslqlisatkadangkgklgkatf
legiitslptlgagqsafkinfewddgsgipgafyiknfmqtefflvsltledipnhgsi
hfvcnswiynaklfksdriffanqty

SCOP Domain Coordinates for d1lnh_2:

Click to download the PDB-style file with coordinates for d1lnh_2.
(The format of our PDB-style files is described here.)

Timeline for d1lnh_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1lnh_1