SCOP 1.73: Domain d2sblb2: 2sbl B:7-149

Lineage for d2sblb2 (2sbl B:7-149)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.12: Lipase/lipooxygenase domain (PLAT/LH2 domain) [49722] (1 superfamily)
   sandwich; 8 strands in 2 sheets; complex topology
   duplication: has weak internal pseudo twofold symmetry

4. Superfamily b.12.1: Lipase/lipooxygenase domain (PLAT/LH2 domain) [49723] (3 families)

5. Family b.12.1.1: Lipoxigenase N-terminal domain [49724] (2 proteins)

6. Protein Plant lipoxigenase [49725] (2 species)

7. Species Soybean (Glycine max), isozyme L1 [TaxId:3847] [49726] (9 PDB entries)

8. Domain d2sblb2: 2sbl B:7-149 [23635]
   Other proteins in same PDB: d2sbla1, d2sblb1
   complexed with fe

Details for d2sblb2

PDB Entry: 2sbl, 2.6 Å

PDB Description: the three-dimensional structure of an arachidonic acid 15-lipoxygenase

PDB Compounds: (B:) lipoxygenase-1

SCOP Domain Sequences for d2sblb2:

Sequence, based on SEQRES records:

>d2sblb2 b.12.1.1 (B:7-149) Plant lipoxigenase {Soybean (Glycine max), isozyme L1 [TaxId: 3847]}
kikgtvvlmpknelevnpdgsavdnlnaflgrsvslqlisatkadahgkgkvgkdtfleg
intslptlgagesafnihfewdgsmgipgafyiknymqvefflksltleaisnqgtirfv
cnswvyntklyksvriffanhty

Sequence, based on observed residues (ATOM records):

>d2sblb2 b.12.1.1 (B:7-149) Plant lipoxigenase {Soybean (Glycine max), isozyme L1 [TaxId: 3847]}
kikgtvvlmpknelelnaflgrsvslqlisatkadahgkgkvgkdtfleginlgagesaf
nihfewdgsmgipgafyiknymqvefflksltleaitirfvcnswvyntklyksvriffa
nhty

Timeline for d2sblb2:

• d2sblb2 first appeared (with stable ids) in SCOP 1.55
  
• d2sblb2 appears in SCOP 1.71
  
• d2sblb2 appears in SCOP 1.75
  
• d2sblb2 appears in the current release, SCOPe 2.08