Lineage for d1yge_2 (1yge 1-149)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 370096Fold b.12: Lipase/lipooxygenase domain (PLAT/LH2 domain) [49722] (1 superfamily)
    sandwich; 8 strands in 2 sheets; complex topology
    duplication: has weak internal pseudo twofold symmetry
  4. 370097Superfamily b.12.1: Lipase/lipooxygenase domain (PLAT/LH2 domain) [49723] (3 families) (S)
  5. 370098Family b.12.1.1: Lipoxigenase N-terminal domain [49724] (2 proteins)
  6. 370102Protein Plant lipoxigenase [49725] (2 species)
  7. 370103Species Soybean (Glycine max), isozyme L1 [TaxId:3847] [49726] (8 PDB entries)
  8. 370105Domain d1yge_2: 1yge 1-149 [23634]
    Other proteins in same PDB: d1yge_1
    complexed with fe

Details for d1yge_2

PDB Entry: 1yge (more details), 1.4 Å

PDB Description: lipoxygenase-1 (soybean) at 100k

SCOP Domain Sequences for d1yge_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yge_2 b.12.1.1 (1-149) Plant lipoxigenase {Soybean (Glycine max), isozyme L1}
mfsaghkikgtvvlmpknelevnpdgsavdnlnaflgrsvslqlisatkadahgkgkvgk
dtflegintslptlgagesafnihfewdgsmgipgafyiknymqvefflksltleaisnq
gtirfvcnswvyntklyksvriffanhty

SCOP Domain Coordinates for d1yge_2:

Click to download the PDB-style file with coordinates for d1yge_2.
(The format of our PDB-style files is described here.)

Timeline for d1yge_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1yge_1