Lineage for d1c01a_ (1c01 A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2383151Fold b.11: gamma-Crystallin-like [49694] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key
    duplication: has internal pseudo twofold symmetry
  4. 2383152Superfamily b.11.1: gamma-Crystallin-like [49695] (7 families) (S)
  5. 2383294Family b.11.1.5: Plant antimicrobial protein MIAMP1 [49719] (1 protein)
    automatically mapped to Pfam PF09117
  6. 2383295Protein Plant antimicrobial protein MIAMP1 [49720] (1 species)
  7. 2383296Species Macadamia nut (Macadamia integrifolia) [TaxId:60698] [49721] (1 PDB entry)
  8. 2383297Domain d1c01a_: 1c01 A: [23633]

Details for d1c01a_

PDB Entry: 1c01 (more details)

PDB Description: solution structure of miamp1, a plant antimicrobial protein
PDB Compounds: (A:) antimicrobial peptide 1

SCOPe Domain Sequences for d1c01a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c01a_ b.11.1.5 (A:) Plant antimicrobial protein MIAMP1 {Macadamia nut (Macadamia integrifolia) [TaxId: 60698]}
saftvwsgpgcnnraeryskcgcsaihqkggydfsytgqtaalynqagcsgvahtrfgss
aracnpfgwksifiqc

SCOPe Domain Coordinates for d1c01a_:

Click to download the PDB-style file with coordinates for d1c01a_.
(The format of our PDB-style files is described here.)

Timeline for d1c01a_: