SCOP 1.57: Domain d1bhu__: 1bhu -

Lineage for d1bhu__ (1bhu -)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.11: gamma-Crystallin-like [49694] (1 superfamily)

4. Superfamily b.11.1: gamma-Crystallin-like [49695] (6 families)

5. Family b.11.1.3: Streptomyces metalloproteinase inhibitor, SMPI [49713] (1 protein)

6. Protein Streptomyces metalloproteinase inhibitor, SMPI [49714] (1 species)

7. Species Streptomyces nigrescens [TaxId:1920] [49715] (1 PDB entry)

8. Domain d1bhu__: 1bhu - [23631]

Details for d1bhu__

PDB Entry: 1bhu

PDB Description: the 3d structure of the streptomyces metalloproteinase inhibitor, smpi, isolated from streptomyces nigrescens tk-23, nmr, minimized average structure

SCOP Domain Sequences for d1bhu__:

Sequence; same for both SEQRES and ATOM records:

>d1bhu__ b.11.1.3 (-) Streptomyces metalloproteinase inhibitor, SMPI {Streptomyces nigrescens}
apscpagslctysgtglsgartvipasdmekagtdgvklpasarsfangthftlrygpar
kvtcvrfpcyqyatvgkvapgaqlrslpspgatvtvgqdlgd

Timeline for d1bhu__:

• d1bhu__ first appeared (with stable ids) in SCOP 1.55
  
• d1bhu__ appears in SCOP 1.59
  
• d1bhu__ appears in the current release, SCOPe 2.08, called d1bhua_