| Class b: All beta proteins [48724] (180 folds) |
| Fold b.11: gamma-Crystallin-like [49694] (1 superfamily) sandwich; 8 strands in 2 sheets; greek-key duplication: has internal pseudo twofold symmetry |
Superfamily b.11.1: gamma-Crystallin-like [49695] (7 families) ![]() |
| Family b.11.1.3: Streptomyces metalloproteinase inhibitor, SMPI [49713] (1 protein) automatically mapped to Pfam PF03995 |
| Protein Streptomyces metalloproteinase inhibitor, SMPI [49714] (1 species) |
| Species Streptomyces nigrescens [TaxId:1920] [49715] (1 PDB entry) |
| Domain d1bhua_: 1bhu A: [23631] |
PDB Entry: 1bhu (more details)
SCOPe Domain Sequences for d1bhua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bhua_ b.11.1.3 (A:) Streptomyces metalloproteinase inhibitor, SMPI {Streptomyces nigrescens [TaxId: 1920]}
apscpagslctysgtglsgartvipasdmekagtdgvklpasarsfangthftlrygpar
kvtcvrfpcyqyatvgkvapgaqlrslpspgatvtvgqdlgd
Timeline for d1bhua_: