SCOPe 2.08: Domain d1bhua_: 1bhu A:

Lineage for d1bhua_ (1bhu A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.11: gamma-Crystallin-like [49694] (1 superfamily)
   sandwich; 8 strands in 2 sheets; greek-key
   duplication: has internal pseudo twofold symmetry

4. Superfamily b.11.1: gamma-Crystallin-like [49695] (7 families)

5. Family b.11.1.3: Streptomyces metalloproteinase inhibitor, SMPI [49713] (1 protein)
   automatically mapped to Pfam PF03995

6. Protein Streptomyces metalloproteinase inhibitor, SMPI [49714] (1 species)

7. Species Streptomyces nigrescens [TaxId:1920] [49715] (1 PDB entry)

8. Domain d1bhua_: 1bhu A: [23631]

Details for d1bhua_

PDB Entry: 1bhu

PDB Description: the 3d structure of the streptomyces metalloproteinase inhibitor, smpi, isolated from streptomyces nigrescens tk-23, nmr, minimized average structure

PDB Compounds: (A:) metalloproteinase inhibitor

SCOPe Domain Sequences for d1bhua_:

Sequence; same for both SEQRES and ATOM records:

>d1bhua_ b.11.1.3 (A:) Streptomyces metalloproteinase inhibitor, SMPI {Streptomyces nigrescens [TaxId: 1920]}
apscpagslctysgtglsgartvipasdmekagtdgvklpasarsfangthftlrygpar
kvtcvrfpcyqyatvgkvapgaqlrslpspgatvtvgqdlgd

Timeline for d1bhua_:

• d1bhua_ first appeared (with stable ids) in SCOP 1.55, called d1bhu__
  
• d1bhua_ appears in SCOPe 2.07