Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily) 8-stranded mixed beta-sheet; 2 layers: alpha/beta |
Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) |
Family d.122.1.1: Heat shock protein 90, HSP90, N-terminal domain [55875] (2 proteins) |
Protein HSP90 [55876] (3 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55877] (32 PDB entries) |
Domain d4ce2a_: 4ce2 A: [236301] automated match to d2brca_ complexed with bo5 |
PDB Entry: 4ce2 (more details), 2.38 Å
SCOPe Domain Sequences for d4ce2a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ce2a_ d.122.1.1 (A:) HSP90 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} masetfefqaeitqlmsliintvysnkeiflrelisnasdaldkirykslsdpkqletep dlfiritpkpeqkvleirdsgigmtkaelinnlgtiaksgtkafmealsagadvsmigqf gvgfyslflvadrvqvisksnddeqyiwesnaggsftvtldevnerigrgtilrlflkdd qleyleekrikevikrhsefvaypiqlvvtkeve
Timeline for d4ce2a_: