Class b: All beta proteins [48724] (176 folds) |
Fold b.11: gamma-Crystallin-like [49694] (1 superfamily) sandwich; 8 strands in 2 sheets; greek-key duplication: has internal pseudo twofold symmetry |
Superfamily b.11.1: gamma-Crystallin-like [49695] (7 families) |
Family b.11.1.2: Yeast killer toxin [49710] (1 protein) automatically mapped to Pfam PF09207 |
Protein Yeast killer toxin [49711] (1 species) |
Species Williopsis mrakii [TaxId:4963] [49712] (1 PDB entry) |
Domain d1wkta_: 1wkt A: [23630] |
PDB Entry: 1wkt (more details)
SCOPe Domain Sequences for d1wkta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wkta_ b.11.1.2 (A:) Yeast killer toxin {Williopsis mrakii [TaxId: 4963]} gdgylimckncdpntgscdwkqnwntcvgiganvhwmvtggstdgkqgcatiwegsgcvg rsttmccpantccnintgfyirsyrrve
Timeline for d1wkta_: