Lineage for d1wkt__ (1wkt -)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 11845Fold b.11: gamma-Crystallin-like [49694] (1 superfamily)
  4. 11846Superfamily b.11.1: gamma-Crystallin-like [49695] (5 families) (S)
  5. 11904Family b.11.1.2: Yeast killer toxin [49710] (1 protein)
  6. 11905Protein Yeast killer toxin [49711] (1 species)
  7. 11906Species Williopsis mrakii [TaxId:4963] [49712] (1 PDB entry)
  8. 11907Domain d1wkt__: 1wkt - [23630]

Details for d1wkt__

PDB Entry: 1wkt (more details)

PDB Description: williopsis mrakii killer toxin, nmr solution structure

SCOP Domain Sequences for d1wkt__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wkt__ b.11.1.2 (-) Yeast killer toxin {Williopsis mrakii}
gdgylimckncdpntgscdwkqnwntcvgiganvhwmvtggstdgkqgcatiwegsgcvg
rsttmccpantccnintgfyirsyrrve

SCOP Domain Coordinates for d1wkt__:

Click to download the PDB-style file with coordinates for d1wkt__.
(The format of our PDB-style files is described here.)

Timeline for d1wkt__: