Lineage for d1wkta_ (1wkt A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2773464Fold b.11: gamma-Crystallin-like [49694] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key
    duplication: has internal pseudo twofold symmetry
  4. 2773465Superfamily b.11.1: gamma-Crystallin-like [49695] (7 families) (S)
  5. 2773595Family b.11.1.2: Yeast killer toxin [49710] (1 protein)
    automatically mapped to Pfam PF09207
  6. 2773596Protein Yeast killer toxin [49711] (1 species)
  7. 2773597Species Williopsis mrakii [TaxId:4963] [49712] (1 PDB entry)
  8. 2773598Domain d1wkta_: 1wkt A: [23630]

Details for d1wkta_

PDB Entry: 1wkt (more details)

PDB Description: williopsis mrakii killer toxin, nmr solution structure
PDB Compounds: (A:) yeast killer toxin

SCOPe Domain Sequences for d1wkta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wkta_ b.11.1.2 (A:) Yeast killer toxin {Williopsis mrakii [TaxId: 4963]}
gdgylimckncdpntgscdwkqnwntcvgiganvhwmvtggstdgkqgcatiwegsgcvg
rsttmccpantccnintgfyirsyrrve

SCOPe Domain Coordinates for d1wkta_:

Click to download the PDB-style file with coordinates for d1wkta_.
(The format of our PDB-style files is described here.)

Timeline for d1wkta_: