Lineage for d4bvub_ (4bvu B:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1642804Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 1642805Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 1642806Family d.20.1.1: UBC-related [54496] (7 proteins)
  6. 1642814Protein Ubiquitin conjugating enzyme, UBC [54497] (33 species)
  7. 1642850Species Human (Homo sapiens), E2 D3 [TaxId:9606] [143054] (3 PDB entries)
    Uniprot P61077 1-147
  8. 1642853Domain d4bvub_: 4bvu B: [236292]
    Other proteins in same PDB: d4bvuc_
    automated match to d3ugba_

Details for d4bvub_

PDB Entry: 4bvu (more details), 2.7 Å

PDB Description: structure of shigella effector ospg in complex with host ubch5c- ubiquitin conjugate
PDB Compounds: (B:) Ubiquitin-conjugating enzyme E2 D3

SCOPe Domain Sequences for d4bvub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4bvub_ d.20.1.1 (B:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 D3 [TaxId: 9606]}
alkrinkelsdlardppaqcsagpvgddmfhwqatimgpndspyqggvffltihfptdyp
fkppkvafttriyhpninsngsisldilrsqwspaltiskvllsicsllcdpnpddplvp
eiariyktdrdkynrisrewtqkyam

SCOPe Domain Coordinates for d4bvub_:

Click to download the PDB-style file with coordinates for d4bvub_.
(The format of our PDB-style files is described here.)

Timeline for d4bvub_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4bvuc_