SCOPe 2.08: Domain d4bvub_: 4bvu B:

Lineage for d4bvub_ (4bvu B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.20: UBC-like [54494] (1 superfamily)
   alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2

4. Superfamily d.20.1: UBC-like [54495] (5 families)

5. Family d.20.1.1: UBC-related [54496] (7 proteins)

6. Protein Ubiquitin conjugating enzyme, UBC [54497] (34 species)

7. Species Human (Homo sapiens), E2 D3 [TaxId:9606] [143054] (3 PDB entries)
   Uniprot P61077 1-147

8. Domain d4bvub_: 4bvu B: [236292]
   Other proteins in same PDB: d4bvuc_
   automated match to d3ugba_

Details for d4bvub_

PDB Entry: 4bvu, 2.7 Å

PDB Description: structure of shigella effector ospg in complex with host ubch5c- ubiquitin conjugate

PDB Compounds: (B:) Ubiquitin-conjugating enzyme E2 D3

SCOPe Domain Sequences for d4bvub_:

Sequence; same for both SEQRES and ATOM records:

>d4bvub_ d.20.1.1 (B:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 D3 [TaxId: 9606]}
alkrinkelsdlardppaqcsagpvgddmfhwqatimgpndspyqggvffltihfptdyp
fkppkvafttriyhpninsngsisldilrsqwspaltiskvllsicsllcdpnpddplvp
eiariyktdrdkynrisrewtqkyam

Timeline for d4bvub_:

• d4bvub_ first appeared in SCOPe 2.03
  
• d4bvub_ appears in SCOPe 2.07