SCOPe 2.08: Domain d3zmlb2: 3zml B:87-221

Lineage for d3zmlb2 (3zml B:87-221)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.0: automated matches [227130] (1 protein)
   not a true family

6. Protein automated matches [226831] (73 species)
   not a true protein

7. Species Anopheles funestus [TaxId:62324] [236281] (2 PDB entries)

8. Domain d3zmlb2: 3zml B:87-221 [236288]
   Other proteins in same PDB: d3zmla1, d3zmlb1
   automated match to d2il3a2
   complexed with gsh

Details for d3zmlb2

PDB Entry: 3zml, 1.64 Å

PDB Description: Anopheles funestus glutathione-s-transferase epsilon 2 (GSTe2) protein structure from different alelles: A single amino acid change confers high level of DDT resistance and cross resistance to permethrin in a major malaria vector in Africa

PDB Compounds: (B:) glutathione s-transferase e2

SCOPe Domain Sequences for d3zmlb2:

Sequence; same for both SEQRES and ATOM records:

>d3zmlb2 a.45.1.0 (B:87-221) automated matches {Anopheles funestus [TaxId: 62324]}
pkdpvqqarvnaalhfesgvlfarmrfiferilfygksdipedrieyvqksyrlledtlk
ddfvagskmtiadfscistissimgvvpleqsehpriyewidrlkqlpyyeeanggggtd
lgkfvlakkeenaka

Timeline for d3zmlb2:

• d3zmlb2 first appeared in SCOPe 2.03
  
• d3zmlb2 appears in SCOPe 2.07