Class a: All alpha proteins [46456] (290 folds) |
Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) this domains follows the thioredoxin-like N-terminal domain |
Family a.45.1.0: automated matches [227130] (1 protein) not a true family |
Protein automated matches [226831] (73 species) not a true protein |
Species Anopheles funestus [TaxId:62324] [236281] (2 PDB entries) |
Domain d3zmlb2: 3zml B:87-221 [236288] Other proteins in same PDB: d3zmla1, d3zmlb1 automated match to d2il3a2 complexed with gsh |
PDB Entry: 3zml (more details), 1.64 Å
SCOPe Domain Sequences for d3zmlb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3zmlb2 a.45.1.0 (B:87-221) automated matches {Anopheles funestus [TaxId: 62324]} pkdpvqqarvnaalhfesgvlfarmrfiferilfygksdipedrieyvqksyrlledtlk ddfvagskmtiadfscistissimgvvpleqsehpriyewidrlkqlpyyeeanggggtd lgkfvlakkeenaka
Timeline for d3zmlb2: