SCOPe 2.08: Domain d3zmla1: 3zml A:4-86

Lineage for d3zmla1 (3zml A:4-86)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (195 species)
   not a true protein

7. Species Anopheles funestus [TaxId:62324] [236279] (2 PDB entries)

8. Domain d3zmla1: 3zml A:4-86 [236286]
   Other proteins in same PDB: d3zmla2, d3zmlb2
   automated match to d2il3a1
   complexed with gsh

Details for d3zmla1

PDB Entry: 3zml, 1.64 Å

PDB Description: Anopheles funestus glutathione-s-transferase epsilon 2 (GSTe2) protein structure from different alelles: A single amino acid change confers high level of DDT resistance and cross resistance to permethrin in a major malaria vector in Africa

PDB Compounds: (A:) glutathione s-transferase e2

SCOPe Domain Sequences for d3zmla1:

Sequence; same for both SEQRES and ATOM records:

>d3zmla1 c.47.1.0 (A:4-86) automated matches {Anopheles funestus [TaxId: 62324]}
lvlytlhlsppcraveltakalgleleqkninllagdhltpefmklnpqhtipvldddgt
iiteshaimiylvtkygkddtly

Timeline for d3zmla1:

• d3zmla1 first appeared in SCOPe 2.03
  
• d3zmla1 appears in SCOPe 2.07