Lineage for d3zmla1 (3zml A:4-86)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2878967Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2878968Protein automated matches [190056] (195 species)
    not a true protein
  7. 2879035Species Anopheles funestus [TaxId:62324] [236279] (2 PDB entries)
  8. 2879036Domain d3zmla1: 3zml A:4-86 [236286]
    Other proteins in same PDB: d3zmla2, d3zmlb2
    automated match to d2il3a1
    complexed with gsh

Details for d3zmla1

PDB Entry: 3zml (more details), 1.64 Å

PDB Description: Anopheles funestus glutathione-s-transferase epsilon 2 (GSTe2) protein structure from different alelles: A single amino acid change confers high level of DDT resistance and cross resistance to permethrin in a major malaria vector in Africa
PDB Compounds: (A:) glutathione s-transferase e2

SCOPe Domain Sequences for d3zmla1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zmla1 c.47.1.0 (A:4-86) automated matches {Anopheles funestus [TaxId: 62324]}
lvlytlhlsppcraveltakalgleleqkninllagdhltpefmklnpqhtipvldddgt
iiteshaimiylvtkygkddtly

SCOPe Domain Coordinates for d3zmla1:

Click to download the PDB-style file with coordinates for d3zmla1.
(The format of our PDB-style files is described here.)

Timeline for d3zmla1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3zmla2