Lineage for d3zmkc2 (3zmk C:87-220)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712830Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2712831Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2713795Family a.45.1.0: automated matches [227130] (1 protein)
    not a true family
  6. 2713796Protein automated matches [226831] (73 species)
    not a true protein
  7. 2713823Species Anopheles funestus [TaxId:62324] [236281] (2 PDB entries)
  8. 2713828Domain d3zmkc2: 3zmk C:87-220 [236282]
    Other proteins in same PDB: d3zmka1, d3zmkb1, d3zmkb3, d3zmkc1, d3zmkd1
    automated match to d2il3a2
    complexed with gsh

Details for d3zmkc2

PDB Entry: 3zmk (more details), 2.01 Å

PDB Description: Anopheles funestus glutathione-s-transferase epsilon 2 (GSTe2) protein structure from different alelles: A single amino acid change confers high level of DDT resistance and cross resistance to permethrin in a major malaria vector in Africa
PDB Compounds: (C:) glutathione s-transferase e2

SCOPe Domain Sequences for d3zmkc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zmkc2 a.45.1.0 (C:87-220) automated matches {Anopheles funestus [TaxId: 62324]}
pkdpvqqarvnaalhfesgvlfarmrfiferiffygksdipedrveyvqksyrlledtlk
ddfvagskmtiadfscistissimgvvpleqsehpriyewidrlkqlpyyeeanggggtd
lgkfvlakkeenak

SCOPe Domain Coordinates for d3zmkc2:

Click to download the PDB-style file with coordinates for d3zmkc2.
(The format of our PDB-style files is described here.)

Timeline for d3zmkc2: