SCOPe 2.05: Domain d1hdfb_: 1hdf B:

Lineage for d1hdfb_ (1hdf B:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.11: gamma-Crystallin-like [49694] (1 superfamily)
   sandwich; 8 strands in 2 sheets; greek-key
   duplication: has internal pseudo twofold symmetry

4. Superfamily b.11.1: gamma-Crystallin-like [49695] (7 families)

5. Family b.11.1.1: Crystallins/Ca-binding development proteins [49696] (5 proteins)

6. Protein Spherulin 3a (S3a) [49708] (1 species)

7. Species Slime mold (Physarum polycephalum) [TaxId:5791] [49709] (2 PDB entries)

8. Domain d1hdfb_: 1hdf B: [23628]
   complexed with ca

Details for d1hdfb_

PDB Entry: 1hdf, 2.35 Å

PDB Description: evolution of the eye lens beta-gamma-crystallin domain fold

PDB Compounds: (B:) spherulin 3a

SCOPe Domain Sequences for d1hdfb_:

Sequence; same for both SEQRES and ATOM records:

>d1hdfb_ b.11.1.1 (B:) Spherulin 3a (S3a) {Slime mold (Physarum polycephalum) [TaxId: 5791]}
svckgvsgnpakgevflykhvnfqgdswkvtgnvydfrsvsglndvvssvkvgpntkafi
fkddrfngnfirleessqvtdlttrnlndaissmivatfe

Timeline for d1hdfb_:

• d1hdfb_ first appeared (with stable ids) in SCOP 1.55
  
• d1hdfb_ appears in SCOPe 2.04
  
• d1hdfb_ appears in SCOPe 2.06
  
• d1hdfb_ appears in the current release, SCOPe 2.08