Lineage for d1hdfb_ (1hdf B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2773464Fold b.11: gamma-Crystallin-like [49694] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key
    duplication: has internal pseudo twofold symmetry
  4. 2773465Superfamily b.11.1: gamma-Crystallin-like [49695] (7 families) (S)
  5. 2773466Family b.11.1.1: Crystallins/Ca-binding development proteins [49696] (5 proteins)
  6. 2773574Protein Spherulin 3a (S3a) [49708] (1 species)
  7. 2773575Species Slime mold (Physarum polycephalum) [TaxId:5791] [49709] (2 PDB entries)
  8. 2773577Domain d1hdfb_: 1hdf B: [23628]
    complexed with ca

Details for d1hdfb_

PDB Entry: 1hdf (more details), 2.35 Å

PDB Description: evolution of the eye lens beta-gamma-crystallin domain fold
PDB Compounds: (B:) spherulin 3a

SCOPe Domain Sequences for d1hdfb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hdfb_ b.11.1.1 (B:) Spherulin 3a (S3a) {Slime mold (Physarum polycephalum) [TaxId: 5791]}
svckgvsgnpakgevflykhvnfqgdswkvtgnvydfrsvsglndvvssvkvgpntkafi
fkddrfngnfirleessqvtdlttrnlndaissmivatfe

SCOPe Domain Coordinates for d1hdfb_:

Click to download the PDB-style file with coordinates for d1hdfb_.
(The format of our PDB-style files is described here.)

Timeline for d1hdfb_: