SCOPe 2.07: Domain d3we1a_: 3we1 A:

Lineage for d3we1a_ (3we1 A:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.0: automated matches [191341] (1 protein)
   not a true family

6. Protein automated matches [190226] (72 species)
   not a true protein

7. Species Dengue virus type 4 [TaxId:408871] [236276] (2 PDB entries)

8. Domain d3we1a_: 3we1 A: [236277]
   automated match to d1s6na_

Details for d3we1a_

PDB Entry: 3we1, 2.28 Å

PDB Description: crystal structure of dengue 4 envelope protein domain iii (ed3)

PDB Compounds: (A:) Envelope protein E

SCOPe Domain Sequences for d3we1a_:

Sequence; same for both SEQRES and ATOM records:

>d3we1a_ b.1.18.0 (A:) automated matches {Dengue virus type 4 [TaxId: 408871]}
sytmcsgkfsidkemaetqhgttvvkvkyegagapckvpieirdvnkekvvgriisstpl
aentnsvtnieleppfgdsyivigvgnsaltlhwfrk

Timeline for d3we1a_:

• d3we1a_ first appeared in SCOPe 2.03
  
• d3we1a_ appears in SCOPe 2.06
  
• d3we1a_ appears in the current release, SCOPe 2.08