Lineage for d3we1a_ (3we1 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2765063Superfamily b.1.18: E set domains [81296] (27 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2766140Family b.1.18.0: automated matches [191341] (1 protein)
    not a true family
  6. 2766141Protein automated matches [190226] (81 species)
    not a true protein
  7. 2766234Species Dengue virus type 4 [TaxId:408871] [236276] (2 PDB entries)
  8. 2766235Domain d3we1a_: 3we1 A: [236277]
    automated match to d1s6na_

Details for d3we1a_

PDB Entry: 3we1 (more details), 2.28 Å

PDB Description: crystal structure of dengue 4 envelope protein domain iii (ed3)
PDB Compounds: (A:) Envelope protein E

SCOPe Domain Sequences for d3we1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3we1a_ b.1.18.0 (A:) automated matches {Dengue virus type 4 [TaxId: 408871]}
sytmcsgkfsidkemaetqhgttvvkvkyegagapckvpieirdvnkekvvgriisstpl
aentnsvtnieleppfgdsyivigvgnsaltlhwfrk

SCOPe Domain Coordinates for d3we1a_:

Click to download the PDB-style file with coordinates for d3we1a_.
(The format of our PDB-style files is described here.)

Timeline for d3we1a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3we1b_