![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
![]() | Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) ![]() shares functional and structural similarities with the ATP-grasp fold and PIPK |
![]() | Family d.144.1.0: automated matches [191359] (1 protein) not a true family |
![]() | Protein automated matches [190417] (35 species) not a true protein |
![]() | Species Leishmania donovani [TaxId:981087] [236274] (2 PDB entries) |
![]() | Domain d4o2za1: 4o2z A:19-377 [236275] Other proteins in same PDB: d4o2za2 automated match to d3coia_ complexed with 046 |
PDB Entry: 4o2z (more details), 2.71 Å
SCOPe Domain Sequences for d4o2za1:
Sequence, based on SEQRES records: (download)
>d4o2za1 d.144.1.0 (A:19-377) automated matches {Leishmania donovani [TaxId: 981087]} nqelsvpkivgdfkvynvsgspfevpskytllkilgmgaygiacscldgdtgekvsikkc rdvfrdvedgkrvlreidmmrffhhenllnvvnilpplkreyhsfedvyvvtplmdvdmn vvlrsrqvleeshmqyfvyqilrglkylhsanvahrdlkpanlvtniscelkiidfglsr svdvpyseltdyvitrwyrppelllentnystavdiwsvgcifaemynrkpvfpgrntmd qlrmiaqhigkppasivehrealeklnelpdgslnipklvpglagntegidflskmwtld pskrptaadmlahpylahlhdeedeptcpcpflwahestpmgvselrrafwadivdynp
>d4o2za1 d.144.1.0 (A:19-377) automated matches {Leishmania donovani [TaxId: 981087]} nqelsvpkivgdfkvynvsgspfevpskytllkilgmgaygiacscldgdtgekvsikkc rdvfrdvedgkrvlreidmmrffhhenllnvvnilpplkreyhsfedvyvvtplmdvdmn vvlrsrqvleeshmqyfvyqilrglkylhsanvahrdlkpanlvtniscelkiidfglsr svpyseltdyvitrwyrppelllentnystavdiwsvgcifaemynrkpvfpgrntmdql rmiaqhigkppasivehrealeklnelpdgslnipklvpglagntegidflskmwtldps krptaadmlahpylahlhdeedeptcpcpflwahestpmgvselrrafwadivdynp
Timeline for d4o2za1: