SCOPe 2.05: Domain d4odia_: 4odi A:

Lineage for d4odia_ (4odi A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.60: Phosphoglycerate mutase-like [53253] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 324156; strand 5 is antiparallel to the rest

4. Superfamily c.60.1: Phosphoglycerate mutase-like [53254] (4 families)

5. Family c.60.1.0: automated matches [196988] (1 protein)
   not a true family

6. Protein automated matches [196989] (8 species)
   not a true protein

7. Species Toxoplasma gondii [TaxId:508771] [236270] (1 PDB entry)

8. Domain d4odia_: 4odi A: [236272]
   automated match to d2hhja_
   complexed with na

Details for d4odia_

PDB Entry: 4odi, 2.6 Å

PDB Description: 2.6 angstrom crystal structure of putative phosphoglycerate mutase 1 from toxoplasma gondii

PDB Compounds: (A:) Phosphoglycerate mutase PGMII

SCOPe Domain Sequences for d4odia_:

Sequence; same for both SEQRES and ATOM records:

>d4odia_ c.60.1.0 (A:) automated matches {Toxoplasma gondii [TaxId: 508771]}
gnmakakytlvlirhgestwnkenrftgwtdvplspvgeqeaveaakalkekgfefdvay
tsvlqravvtcwtvlkgtdmchipvksswrlnerhygalqglnkaetaakhgdeqvkiwr
rsydippppleksdkrwpgndavykmvpnealplteclkdtvervlpfwfdhiapsimeg
krvlvaahgnslrglvkhldkmsdeavlelniptgvplvyeldedlqpvrhyylldeael
kakmea

Timeline for d4odia_:

• d4odia_ first appeared in SCOPe 2.03
  
• d4odia_ appears in SCOPe 2.04
  
• d4odia_ appears in SCOPe 2.06
  
• d4odia_ appears in the current release, SCOPe 2.08