Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.60: Phosphoglycerate mutase-like [53253] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 324156; strand 5 is antiparallel to the rest |
Superfamily c.60.1: Phosphoglycerate mutase-like [53254] (4 families) |
Family c.60.1.0: automated matches [196988] (1 protein) not a true family |
Protein automated matches [196989] (8 species) not a true protein |
Species Toxoplasma gondii [TaxId:508771] [236270] (1 PDB entry) |
Domain d4odia_: 4odi A: [236272] automated match to d2hhja_ complexed with na |
PDB Entry: 4odi (more details), 2.6 Å
SCOPe Domain Sequences for d4odia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4odia_ c.60.1.0 (A:) automated matches {Toxoplasma gondii [TaxId: 508771]} gnmakakytlvlirhgestwnkenrftgwtdvplspvgeqeaveaakalkekgfefdvay tsvlqravvtcwtvlkgtdmchipvksswrlnerhygalqglnkaetaakhgdeqvkiwr rsydippppleksdkrwpgndavykmvpnealplteclkdtvervlpfwfdhiapsimeg krvlvaahgnslrglvkhldkmsdeavlelniptgvplvyeldedlqpvrhyylldeael kakmea
Timeline for d4odia_: