SCOP 1.65: Domain d1hdfa_: 1hdf A:

Lineage for d1hdfa_ (1hdf A:)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.11: gamma-Crystallin-like [49694] (1 superfamily)
   sandwich; 8 strands in 2 sheets; greek-key
   duplication: has internal pseudo twofold symmetry

4. Superfamily b.11.1: gamma-Crystallin-like [49695] (6 families)

5. Family b.11.1.1: Crystallins/Ca-binding development proteins [49696] (4 proteins)

6. Protein Spherulin 3a (S3a) [49708] (1 species)

7. Species Slime mold (Physarum polycephalum) [TaxId:5791] [49709] (2 PDB entries)

8. Domain d1hdfa_: 1hdf A: [23627]

Details for d1hdfa_

PDB Entry: 1hdf, 2.35 Å

PDB Description: evolution of the eye lens beta-gamma-crystallin domain fold

SCOP Domain Sequences for d1hdfa_:

Sequence; same for both SEQRES and ATOM records:

>d1hdfa_ b.11.1.1 (A:) Spherulin 3a (S3a) {Slime mold (Physarum polycephalum)}
svckgvsgnpakgevflykhvnfqgdswkvtgnvydfrsvsglndvvssvkvgpntkafi
fkddrfngnfirleessqvtdlttrnlndaissmivatfe

Timeline for d1hdfa_:

• d1hdfa_ first appeared (with stable ids) in SCOP 1.55
  
• d1hdfa_ appears in SCOP 1.63
  
• d1hdfa_ appears in SCOP 1.67
  
• d1hdfa_ appears in the current release, SCOPe 2.08