Lineage for d4o8rl_ (4o8r L:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2090271Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 2090369Family c.1.2.3: Decarboxylase [51375] (4 proteins)
  6. 2090509Protein automated matches [190130] (11 species)
    not a true protein
  7. 2090600Species Methanothermobacter thermautotrophicus [TaxId:187420] [188934] (67 PDB entries)
  8. 2090750Domain d4o8rl_: 4o8r L: [236269]
    automated match to d3g1da_
    complexed with cl, h2u

Details for d4o8rl_

PDB Entry: 4o8r (more details), 2.29 Å

PDB Description: Crystal structure of orotidine 5'-monophosphate decarboxylase from methanobacterium thermoautotrophicum complexed with 5,6-dihydrouridine 5'-monophosphate
PDB Compounds: (L:) orotidine 5'-phosphate decarboxylase

SCOPe Domain Sequences for d4o8rl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4o8rl_ c.1.2.3 (L:) automated matches {Methanothermobacter thermautotrophicus [TaxId: 187420]}
dvmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefrkrfgcriia
dfkvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrevflltemshp
gaemfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflispgvgaqggdp
getlrfadaiivgrsiyladnpaaaaagiiesi

SCOPe Domain Coordinates for d4o8rl_:

Click to download the PDB-style file with coordinates for d4o8rl_.
(The format of our PDB-style files is described here.)

Timeline for d4o8rl_: