Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) |
Family c.1.2.3: Decarboxylase [51375] (4 proteins) |
Protein automated matches [190130] (11 species) not a true protein |
Species Methanothermobacter thermautotrophicus [TaxId:187420] [188934] (67 PDB entries) |
Domain d4o8re_: 4o8r E: [236254] automated match to d3g1da_ complexed with cl, h2u |
PDB Entry: 4o8r (more details), 2.29 Å
SCOPe Domain Sequences for d4o8re_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4o8re_ c.1.2.3 (E:) automated matches {Methanothermobacter thermautotrophicus [TaxId: 187420]} mdvmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefrkrfgcrii adfkvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrevflltemsh pgaemfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflispgvgaqggd pgetlrfadaiivgrsiyladnpaaaaagiiesikdl
Timeline for d4o8re_: