SCOPe 2.08: Domain d1prra2: 1prr A:91-173

Lineage for d1prra2 (1prr A:91-173)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.11: gamma-Crystallin-like [49694] (1 superfamily)
   sandwich; 8 strands in 2 sheets; greek-key
   duplication: has internal pseudo twofold symmetry

4. Superfamily b.11.1: gamma-Crystallin-like [49695] (7 families)

5. Family b.11.1.1: Crystallins/Ca-binding development proteins [49696] (5 proteins)

6. Protein Protein S [49706] (1 species)
   duplication consists of two domains of this fold

7. Species Myxococcus xanthus [TaxId:34] [49707] (3 PDB entries)

8. Domain d1prra2: 1prr A:91-173 [23624]
   complexed with ca

Details for d1prra2

PDB Entry: 1prr

PDB Description: nmr-derived three-dimensional solution structure of protein s complexed with calcium

PDB Compounds: (A:) development-specific protein s

SCOPe Domain Sequences for d1prra2:

Sequence; same for both SEQRES and ATOM records:

>d1prra2 b.11.1.1 (A:91-173) Protein S {Myxococcus xanthus [TaxId: 34]}
prarffykeqfdgkevdlppgqytqaelerygidnntissvkpqglavvlfkndnfsgdt
lpvnsdaptlgamnnntssiris

Timeline for d1prra2:

• d1prra2 first appeared (with stable ids) in SCOP 1.55, called d1prr_2
  
• d1prra2 appears in SCOPe 2.07