SCOPe 2.05: Domain d4ni9c_: 4ni9 C:

Lineage for d4ni9c_ (4ni9 C:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.26: 4-helical cytokines [47265] (1 superfamily)
   core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections

4. Superfamily a.26.1: 4-helical cytokines [47266] (4 families)
   there are two different topoisomers of this fold with different entanglements of the two crossover connections

5. Family a.26.1.1: Long-chain cytokines [47267] (10 proteins)

6. Protein Interleukin-6 [47272] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47273] (8 PDB entries)

8. Domain d4ni9c_: 4ni9 C: [236233]
   automated match to d1alua_
   protein/DNA complex; complexed with na

Details for d4ni9c_

PDB Entry: 4ni9, 2.55 Å

PDB Description: crystal structure of human interleukin 6 in complex with a modified nucleotide aptamer (somamer sl1025), form 2

PDB Compounds: (C:) interleukin-6

SCOPe Domain Sequences for d4ni9c_:

Sequence, based on SEQRES records:

>d4ni9c_ a.26.1.1 (C:) Interleukin-6 {Human (Homo sapiens) [TaxId: 9606]}
rqpltsseridkqiryildgisalrketcnksnmcesskealaennlnlpkmaekdgcfq
sgfneetclvkiitgllefevyleylqnrfesseeqaravqmstkvliqflqkkaknlda
ittpdpttnaslltklqaqnqwlqdmtthlilrsfkeflqsslralrqm

Sequence, based on observed residues (ATOM records):

>d4ni9c_ a.26.1.1 (C:) Interleukin-6 {Human (Homo sapiens) [TaxId: 9606]}
rqpltsseridkqiryildgisalrketnnlnlpkmaekdgcfqsgfneetclvkiitgl
lefevyleylqnrfesseeqaravqmstkvliqflqkkaittpdpttnaslltklqaqnq
wlqdmtthlilrsfkeflqsslralrqm

Timeline for d4ni9c_:

• d4ni9c_ first appeared in SCOPe 2.03
  
• d4ni9c_ appears in SCOPe 2.04
  
• d4ni9c_ appears in SCOPe 2.06
  
• d4ni9c_ appears in the current release, SCOPe 2.08