Lineage for d4ni9c_ (4ni9 C:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2705447Fold a.26: 4-helical cytokines [47265] (1 superfamily)
    core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections
  4. 2705448Superfamily a.26.1: 4-helical cytokines [47266] (4 families) (S)
    there are two different topoisomers of this fold with different entanglements of the two crossover connections
  5. 2705449Family a.26.1.1: Long-chain cytokines [47267] (10 proteins)
  6. 2705489Protein Interleukin-6 [47272] (2 species)
  7. 2705490Species Human (Homo sapiens) [TaxId:9606] [47273] (9 PDB entries)
  8. 2705497Domain d4ni9c_: 4ni9 C: [236233]
    automated match to d1alua_
    protein/DNA complex; complexed with na

Details for d4ni9c_

PDB Entry: 4ni9 (more details), 2.55 Å

PDB Description: crystal structure of human interleukin 6 in complex with a modified nucleotide aptamer (somamer sl1025), form 2
PDB Compounds: (C:) interleukin-6

SCOPe Domain Sequences for d4ni9c_:

Sequence, based on SEQRES records: (download)

>d4ni9c_ a.26.1.1 (C:) Interleukin-6 {Human (Homo sapiens) [TaxId: 9606]}
rqpltsseridkqiryildgisalrketcnksnmcesskealaennlnlpkmaekdgcfq
sgfneetclvkiitgllefevyleylqnrfesseeqaravqmstkvliqflqkkaknlda
ittpdpttnaslltklqaqnqwlqdmtthlilrsfkeflqsslralrqm

Sequence, based on observed residues (ATOM records): (download)

>d4ni9c_ a.26.1.1 (C:) Interleukin-6 {Human (Homo sapiens) [TaxId: 9606]}
rqpltsseridkqiryildgisalrketnnlnlpkmaekdgcfqsgfneetclvkiitgl
lefevyleylqnrfesseeqaravqmstkvliqflqkkaittpdpttnaslltklqaqnq
wlqdmtthlilrsfkeflqsslralrqm

SCOPe Domain Coordinates for d4ni9c_:

Click to download the PDB-style file with coordinates for d4ni9c_.
(The format of our PDB-style files is described here.)

Timeline for d4ni9c_: