Lineage for d4n9ob1 (4n9o B:1-123)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2344610Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2347168Protein automated matches [190119] (20 species)
    not a true protein
  7. 2347651Species Llama (Lama glama) [TaxId:9844] [187485] (155 PDB entries)
  8. 2347669Domain d4n9ob1: 4n9o B:1-123 [236230]
    Other proteins in same PDB: d4n9ob2
    automated match to d2xa3a_

Details for d4n9ob1

PDB Entry: 4n9o (more details), 1.5 Å

PDB Description: Probing the N-terminal beta-sheet conversion in the crystal structure of the human prion protein bound to a Nanobody
PDB Compounds: (B:) Nanobody Nb484

SCOPe Domain Sequences for d4n9ob1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4n9ob1 b.1.1.1 (B:1-123) automated matches {Llama (Lama glama) [TaxId: 9844]}
aaqlqesggglvqpggslrlscaasgrtfssynmgwfrqapgkgrefvasitssgdksdy
tdsvkgrftisrdnakntmylqmnnlkpedtatyycarglgiyiirarggydhwgqgtqv
tvs

SCOPe Domain Coordinates for d4n9ob1:

Click to download the PDB-style file with coordinates for d4n9ob1.
(The format of our PDB-style files is described here.)

Timeline for d4n9ob1: